Antibodies

View as table Download

Goat Polyclonal Anti-TIM-1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TIM-1 Antibody: Peptide with sequence C-THVTYRKDTRYK, from the internal region of the protein sequence according to NP_036338.2.

Goat Anti-POLDIP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Dog, Cow
Immunogen Peptide with sequence C-RFERPDGSHFDVR, from the internal region (near C terminus) of the protein sequence according to NP_056399.1.

Rabbit Polyclonal Anti-POLDIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLDIP2 antibody is: synthetic peptide directed towards the C-terminal region of Human POLDIP2. Synthetic peptide located within the following region: SSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLH

POLDIP2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N region of human POLDIP2

POLDIP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human POLDIP2 (NP_056399.1).
Modifications Unmodified

POLDIP2 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated