Rabbit Polyclonal Anti-POLDIP3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLDIP3 antibody: synthetic peptide directed towards the C terminal of human POLDIP3. Synthetic peptide located within the following region: DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES |
Rabbit polyclonal anti-POLDIP3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLDIP3. |
Rabbit polyclonal POLDIP3 Antibody (N-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This POLDIP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the N-terminal region of human POLDIP3. |
POLDIP3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
POLDIP3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human POLDIP3 |
POLDIP3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human POLDIP3 |
Germany
Japan
United Kingdom
China