Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-POLK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLK antibody: synthetic peptide directed towards the N terminal of human POLK. Synthetic peptide located within the following region: KINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQL |
Rabbit Polyclonal Anti-POLK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLK antibody: synthetic peptide directed towards the middle region of human POLK. Synthetic peptide located within the following region: ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ |
Goat polyclonal anti-POLK antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 817-830 of Human POLK (polymerase (DNA directed) kappa). |
POLK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human POLK (NP_057302.1). |
| Modifications | Unmodified |
POLK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human POLK (NP_057302.1). |
| Modifications | Unmodified |
POLK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human POLK (NP_057302.1). |
| Modifications | Unmodified |
POLK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human POLK (NP_057302.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- POLK