Antibodies

Jump to Filters
View as table Download
DNA polymerase mu (POLM) Rabbit Polyclonal Antibody
TA334472

USD 375.00

5 Days

Rabbit Polyclonal Anti-POLM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLM antibody: synthetic peptide directed towards the middle region of human POLM. Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN
POLM Rabbit Polyclonal Antibody
TA385003

USD 380.00

4 Weeks

DNA Polymerase mu Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from DNA Pol μ . at AA range: 210-290