Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal POLR2A (Ab-1619) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S). |
POLR2A (794-822) mouse monoclonal antibody, clone ARNA-3, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Drosophila, Human |
Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody
| Applications | Dot, WB |
| Reactivities | Human, Chicken, Drosophila, Yeast |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928] |
Rabbit Polyclonal Anti-POLR2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR2A antibody is: synthetic peptide directed towards the N-terminal region of Human POLR2A. Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ |
Mouse monoclonal Anti-RNA polII Clone CTD 4H8
| Reactivities | Human, Saccharomyces cerevisiae |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2A mouse monoclonal antibody,clone OTI3C8
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
POLR2A Rabbit polyclonal Antibody
| Applications | ChIP, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human POLR2A (NP_000928.1). |
| Modifications | Unmodified |
Phospho-POLR2A-S2 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S2 of human POLR2A |
| Modifications | Phospho S2 |
Phospho-POLR2A-S5 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S5 of human POLR2A |
| Modifications | Phospho S5 |
Phospho-POLR2A-S7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around of human Phospho-POLR2A-S7. |
| Modifications | Phospho S7 |
Rpb1 (phospho-S1619) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human Rpb1 around the phosphorylation site of Serine 1619. |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
POLR2A mouse monoclonal antibody,clone OTI3C8, Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POLR2A mouse monoclonal antibody,clone OTI3C8, HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Active filters
Target Symbol
- POLR2A