Antibodies

View as table Download

POLR2I Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human POLR2I

Anti-POLR2I Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-POLR2I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: ACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQ

Rabbit Polyclonal Anti-POLR2I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS