Rabbit Polyclonal Anti-POTEA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POTEA Antibody is: synthetic peptide directed towards the C-terminal region of Human POTEA. Synthetic peptide located within the following region: EKVTQEPDINKDCDREVEEEMQKHGSNNVGLSENLTDGAAAGNGDGGLVP |
Rabbit Polyclonal Anti-POTEA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POTEA antibody is: synthetic peptide directed towards the middle region of Human POTEA. Synthetic peptide located within the following region: NNSSGNSNPEQDLKLTSEEEPQRLKGSENSQHEKVTQEPDINKDCDREVE |
Germany
Japan
United Kingdom
China