Antibodies

Jump to Filters
View as table Download
POTEB3 (C-term) Rabbit Polyclonal Antibody
AP53394PU-N

USD 450.00

2 Weeks

POTEB3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 388-419 amino acids from the C-terminal region of human POTEB / A26B1
POTEB3 Rabbit Polyclonal Antibody
TA331493

USD 375.00

5 Days

Rabbit Polyclonal Anti-POTEB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POTEB Antibody is: synthetic peptide directed towards the C-terminal region of Human POTEB. Synthetic peptide located within the following region: AGNGDDGLIPQRKSRKPENQQFPDTENEEYHSDEQNDTQKQLSEEQNTGI