Germany
Japan
United Kingdom
China
Rabbit anti-POU2F1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human POU2F1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-OCT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OCT1 Antibody: A synthesized peptide derived from human 41183 |
Oct-1 (POU2F1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Goat Anti-POU2F1 / OCT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NVQSKSNEESGDSQQ, from the internal region (near N Terminus) of the protein sequence according to NP_002688.2. |
Rabbit polyclonal anti-Oct-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 727 of human Oct-1 |
Rabbit Polyclonal Anti-POU2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the N terminal of human POU2F1. Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP |
Rabbit polyclonal Anti-POU2F1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the C terminal of mouse POU2F1. Synthetic peptide located within the following region: VTSSTATTLTVNPVLPLTSAAVTNLSLTGKQQPAYRLVSTVPVRFLWRTA |
Rabbit Polyclonal Anti-POU2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POU2F1 Antibody: synthetic peptide directed towards the N terminal of human POU2F1. Synthetic peptide located within the following region: MADGGAASQDESSAAAAAAADSRMNNPSETSKPSMESGDGNTGTQTNGLD |
Anti-POU2F1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-290 amino acids of human POU class 2 homeobox 1 |
POU2F1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N region of human POU2F1 |
POU2F1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POU2F1 |
POU2F1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POU2F1 |
POU2F1/OCT1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 15-290 of human POU2F1/OCT1 (NP_001185712.1). |
| Modifications | Unmodified |
N WASP Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human WASL |
Active filters
Target Symbol
- POU2F1