Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-OCT2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OCT2 Antibody: A synthesized peptide derived from human 41184 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-POU2F2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POU2F2 Antibody: synthetic peptide directed towards the N terminal of human POU2F2. Synthetic peptide located within the following region: SPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSGDSAPA |
Rabbit anti OCT-2 Polyclonal Antibody
| Applications | Dot |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-terminus of OCT-2 protein from human, mouse and rat origins. |
Mouse Monoclonal OCT-2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
POU2F2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F2 |
Active filters
Target Symbol
- POU2F2