Rabbit Polyclonal Anti-POU2F3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | POU2F3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human POU2F3. |
Rabbit Polyclonal Anti-POU2F3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | POU2F3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human POU2F3. |
Rabbit Polyclonal Anti-POU2F3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POU2F3 antibody: synthetic peptide directed towards the N terminal of human POU2F3. Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR |
Rabbit Polyclonal Anti-POU2F3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-POU2F3 antibody is: synthetic peptide directed towards the C-terminal region of Human POU2F3. Synthetic peptide located within the following region: LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN |
Rabbit Polyclonal Anti-POU2F3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POU2F3 antibody: synthetic peptide directed towards the N terminal of human POU2F3. Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR |
Goat Anti-POU2F3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EPHLEASQHLPVPKH, from the internal region of the protein sequence according to NP_055167.2. |
POU2F3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU2F3 (NP_055167.2). |
Modifications | Unmodified |