Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-POU3F2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POU3F2 antibody: synthetic peptide directed towards the middle region of human POU3F2. Synthetic peptide located within the following region: LGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPG |
POU3F2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 198-226 amino acids from the central region of human POU3F2 |
Goat Anti-POU3F2 / BRN2 / OCT7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AQSLVQGDYGALQSN, from the internal region (near N Terminus) of the protein sequence according to NP_005595.2. |
Rabbit Polyclonal Anti-POU3F2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POU3F2 antibody: synthetic peptide directed towards the C terminal of human POU3F2. Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP |
POU3F2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human POU3F2. |
Active filters
Target Symbol
- POU3F2