Rabbit Polyclonal Anti-POU6F2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POU6F2 antibody: synthetic peptide directed towards the N terminal of human POU6F2. Synthetic peptide located within the following region: AATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQ |
Rabbit Polyclonal Anti-POU6F2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POU6F2 antibody: synthetic peptide directed towards the C terminal of human POU6F2. Synthetic peptide located within the following region: PSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRV |
POU6F2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human POU6F2 |
Goat Anti-POU6F2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RSEMNAELRGEDK-C, from the N Terminus of the protein sequence according to NP_009183.3; NP_001159490.1. |
Rabbit polyclonal POU6F2 Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This POU6F2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human POU6F2. |
Rabbit Polyclonal anti-POU6F2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POU6F2 antibody: synthetic peptide directed towards the N terminal of human POU6F2. Synthetic peptide located within the following region: MSALLQDPMIAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPV |
Rabbit Polyclonal Anti-POU6F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human POU6F2 |
Germany
Japan
United Kingdom
China