Antibodies

View as table Download

Rabbit anti-PPARD Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish
Immunogen Synthetic peptide from the C-terminus of human PPARD

Ppard (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Human, Monkey, Mouse, Rabbit, Rat
Immunogen Syntetic peptide corresponding to amino acids 1-14 of mouse PPAR delta.

PPAR delta (PPARD) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 374-402 amino acids from the C-terminal region of human PPAR-delta

Rabbit Polyclonal Anti-PPARD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARD antibody: synthetic peptide directed towards the n terminal of human PPARD. Synthetic peptide located within the following region: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS

Rabbit Polyclonal Anti-PPARD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Goat Polyclonal Antibody against PPAR delta (Isoform 1)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CHPLLQEIYKDMY, from the C Terminus of the protein sequence according to NP_006229.1.

Rabbit polyclonal PPAR Delta antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of mouse PPAR delta.

Rabbit polyclonal PPARD Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PPARD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human PPARD.

Rabbit Polyclonal Anti-PPARD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPARD Antibody: synthetic peptide directed towards the middle region of human PPARD. Synthetic peptide located within the following region: NPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIET

Rabbit anti PPARb Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The full-length recombinant protein of human PPAR-beta.

Rabbit anti PPARd Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPARD mouse monoclonal antibody,clone OTI2D2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPARD mouse monoclonal antibody,clone OTI4D10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PPARD Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of human peroxisome proliferator-activated receptor delta

PPARD Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse PPARD