Antibodies

Jump to Filters
View as table Download
PPHLN1 Rabbit Polyclonal Antibody
TA311690

USD 345.00

In Stock

Rabbit polyclonal anti-PPHLN antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPHLN.
PPHLN1 Rabbit Polyclonal Antibody
TA344584

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPHLN1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPHLN1 antibody: synthetic peptide directed towards the N terminal of human PPHLN1. Synthetic peptide located within the following region: MAYRRDEMWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDR
PPHLN1 Rabbit Polyclonal Antibody
TA319929

USD 430.00

5 Days

Rabbit Polyclonal Periphilin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Periphilin antibody was raised against a 16 amino acid synthetic peptide near the center of human Periphilin.
PPHLN1 Rabbit Polyclonal Antibody
TA328130

USD 450.00

5 Days

Rabbit polyclonal anti-PPHLN1 antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PPHLN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 45-66 amino acids from the N-terminal region of human PPHLN1.
PPHLN1 Rabbit Polyclonal Antibody
TA380207

USD 220.00

3 Weeks

PPHLN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 195-255 of human PPHLN1 (NP_958846.1).
Modifications Unmodified