Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against PPID / CyP-40
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1. |
Antibodies
View as table Download
Rabbit polyclonal Anti-PPID Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPID antibody: synthetic peptide directed towards the N terminal of human PPID. Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM |
Cyclophilin 40 (PPID) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PPID |
Rabbit polyclonal Anti-PPID Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPID antibody: synthetic peptide directed towards the middle region of human PPID. Synthetic peptide located within the following region: AECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKN |
PPID Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse PPID |
Cyclophilin 40 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 161-370 of human Cyclophilin 40 (NP_005029.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PPID