Antibodies

View as table Download

Rabbit Polyclonal Anti-PPIL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIL2 antibody: synthetic peptide directed towards the middle region of human PPIL2. Synthetic peptide located within the following region: MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP

Rabbit Polyclonal Anti-PPIL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIL2 antibody: synthetic peptide directed towards the C terminal of human PPIL2. Synthetic peptide located within the following region: GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ