Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PPM1H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPM1H antibody is: synthetic peptide directed towards the N-terminal region of Human PPM1H. Synthetic peptide located within the following region: TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSK |
PPM1H Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PPM1H |
PPM1H Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PPM1H |
Active filters
Target Symbol
- PPM1H