Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-IASPP antibody for SISCAPA, clone OTIR1G11
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PPP1R13L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the middle region of human PPP1R13L. Synthetic peptide located within the following region: GLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHG |
Rabbit polyclonal anti-iASSP antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 780-797 of human iASPP (isoform 1) protein. |
Rabbit Polyclonal Anti-PPP1R13L Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the middle region of human PPP1R13L. Synthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL |
Rabbit Polyclonal Anti-PPP1R13L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the C terminal of human PPP1R13L. Synthetic peptide located within the following region: EGPPKPPTELEPEPEIEGLLTPVLEAGDVDEGPVARPLSPTRLQPALPPE |
Anti-PPP1R13L Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 781-797 amino acids of Human protein phosphatase 1, regulatory subunit 13 like |
PPP1R13L Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 589-828 of human PPP1R13L (NP_006654.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PPP1R13L