Rabbit Polyclonal Anti-PPP1R9A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R9A antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1R9A. Synthetic peptide located within the following region: VKKKLKEMKMSLEKARKAQEKMEKQREKLRRKEQEQMQRKSKKTEKMTST |
Rabbit Polyclonal Anti-PPP1R9A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R9A antibody is: synthetic peptide directed towards the N-terminal region of Human PPP1R9A. Synthetic peptide located within the following region: GERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGR |
Germany
Japan
United Kingdom
China