Rabbit Polyclonal Anti-PPP2R5D Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R5D antibody: synthetic peptide directed towards the middle region of human PPP2R5D. Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA |
PPP2R5D rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Synthetic peptide conjugated to KLH derived from the N-terminus of PP2A/B delta |
Goat Polyclonal Antibody against PPP2R5D
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRAEEFLTASQEAL, from the C Terminus of the protein sequence according to NP_006236. |
Rabbit polyclonal anti-PPP2R5D antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP2R5D. |
Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI10D11 (formerly 10D11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PP2A-B56δ/PR61δ/PPP2R5D Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D (NP_006236.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PPP2R5D mouse monoclonal antibody, clone OTI10D11 (formerly 10D11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPP2R5D mouse monoclonal antibody, clone OTI10D11 (formerly 10D11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
PPP2R5D mouse monoclonal antibody, clone OTI10D11 (formerly 10D11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PPP2R5D mouse monoclonal antibody, clone OTI10D11 (formerly 10D11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PPP2R5D mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPP2R5D mouse monoclonal antibody, clone OTI2F2 (formerly 2F2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PPP2R5D mouse monoclonal antibody, clone OTI2F2 (formerly 2F2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PPP2R5D mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
