Rabbit Polyclonal Anti-SMEK2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Smek2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK |
SMEK2 (PPP4R3B) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 719-748 amino acids from the C-terminal region of human SMEK2 |
PPP4R3B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human P4R3B |
PPP4R3B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SMEK2 |
PPP4R3B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SMEK2 |
PPP4R3B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SMEK2 |
PPP4R3B Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 628-817 of human PPP4R3B (NP_001269779.1). |
Germany
Japan
United Kingdom
China