Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PRDX6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
Peroxiredoxin 6 (PRDX6) mouse monoclonal antibody, clone 4A3, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-PRDX6 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the middle region of human PRDX6. Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD |
Peroxiredoxin 6 (PRDX6) (C-term) rabbit polyclonal antibody
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human PRDX6. |
Goat Anti-peroxiredoxin 6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EANTTVGRIRFHD, from the internal region (near N terminus) of the protein sequence according to NP_004896.1. |
Anti-PRDX6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
PRDX6 mouse monoclonal antibody, clone OTI4D1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
2 Weeks
USD 420.00
2 Weeks
PRDX6 mouse monoclonal antibody, clone OTI3A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
2 Weeks
USD 420.00
2 Weeks
PRDX6 mouse monoclonal antibody, clone OTI11B8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Active filters
Target Symbol
- PRDX6