Rabbit Polyclonal Anti-PREB Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Preb antibody is synthetic peptide directed towards the N-terminal region of Mouse Preb. Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL |
Rabbit Polyclonal Anti-PREB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PREB antibody: synthetic peptide directed towards the N terminal of human PREB. Synthetic peptide located within the following region: RVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKV |
Germany
Japan
United Kingdom
China
