Antibodies

View as table Download

PRF1 Rabbit Polyclonal Antibody

Applications ELISA, ICC/IF, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR

Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Azide Free

Applications FC, IHC, WB
Reactivities Human

Perforin (PRF1) mouse monoclonal antibody, clone B-D48, FITC

Applications FC
Reactivities Human
Conjugation FITC

Perforin (PRF1) mouse monoclonal antibody, clone B-D48, PerCP

Applications FC
Conjugation PerCP

Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Purified

Applications FC
Reactivities Human

Perforin (PRF1) mouse monoclonal antibody, clone B-D48, PE

Applications FC
Reactivities Human
Conjugation PE

Rabbit polyclonal antibody to Perforin 1 (perforin 1 (pore forming protein))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 9 and 214 of Perforin 1 (Uniprot ID#P14222)

Carrier-free (BSA/glycerol-free) Perforin-1 mouse monoclonal antibody, clone OTI3D7

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Perforin-1 mouse monoclonal antibody, clone OTI10A2

Applications IHC
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Perforin Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Perforin Mouse Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Perforin Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the C-terminal region of human PRF1. AA range:451-500