Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Azide Free
| Applications | FC, IHC, WB |
| Reactivities | Human |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, PerCP
| Applications | FC |
| Conjugation | PerCP |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Purified
| Applications | FC |
| Reactivities | Human |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Rabbit polyclonal antibody to Perforin 1 (perforin 1 (pore forming protein))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 9 and 214 of Perforin 1 (Uniprot ID#P14222) |
Mouse Monoclonal Perforin Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Perforin Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Active filters
Target Symbol
- PRF1