Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PRKCG antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKCG. |
Antibodies
View as table Download
Rabbit polyclonal PRKCG (Ab-655) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P). |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
PKC gamma (PRKCG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human PKC gamma |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the middle region of human PRKCG. Synthetic peptide located within the following region: WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG |
Rabbit Polyclonal Anti-PRKCG Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKCG |
PRKCG rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKCG |
PKC gamma Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PKC gamma |
| Modifications | Unmodified |
Active filters
Target Symbol
- PRKCG
Filter by
Category
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Families
Pathways
- Calcium signaling pathway (6)
- ErbB signaling pathway (6)
- Fc gamma R-mediated phagocytosis (6)
- Focal adhesion (6)
- Gap junction (6)
- Glioma (6)
- Leukocyte transendothelial migration (6)
- Long-term depression (6)
- Long-term potentiation (6)
- MAPK signaling pathway (6)
- Melanogenesis (6)
- Natural killer cell mediated cytotoxicity (6)
- Non-small cell lung cancer (6)
- Pathways in cancer (6)
- Phosphatidylinositol signaling system (6)
- Tight junction (6)
- VEGF signaling pathway (6)
- Vascular smooth muscle contraction (6)
- Vibrio cholerae infection (6)
- Wnt signaling pathway (6)