Antibodies

Jump to Filters
View as table Download
PKC iota (PRKCI) Rabbit Polyclonal Antibody
TA342150

USD 375.00

5 Days

Rabbit polyclonal Anti-PRKCI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCI antibody: synthetic peptide directed towards the middle region of human PRKCI. Synthetic peptide located within the following region: TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS
PKC iota (PRKCI) Rabbit Polyclonal Antibody
TA380368

USD 220.00

3 Weeks

PRKCI Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKCI.