Antibodies

Jump to Filters
View as table Download
PROP1 Rabbit Polyclonal Antibody
TA343595

USD 375.00

5 Days

Rabbit Polyclonal Anti-PROP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PROP1 antibody: synthetic peptide directed towards the middle region of human PROP1. Synthetic peptide located within the following region: PSQPSTGGAFALSHQSEDWYPTLHPAPAGHLPCPPPPPMLPLSLEPSKSW
PROP1 Rabbit Polyclonal Antibody
TA380399

USD 220.00

3 Weeks

PROP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PROP1 (NP_006252.3).