Germany
Japan
United Kingdom
China
PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH |
Antibodies
View as table DownloadRabbit Polyclonal Anti-PRPF19 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK |
Rabbit Polyclonal Anti-PRPF19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the N terminal of human PRPF19. Synthetic peptide located within the following region: VPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP |
PRPF19 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PRPF19 |
PRP19 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 127-416 of human PRP19 (NP_055317.1). |
| Modifications | Unmodified |
PRP19 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human PRP19 (NP_055317.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PRPF19