Antibodies

View as table Download

Rabbit Polyclonal Anti-PRR11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRR11 antibody: synthetic peptide directed towards the middle region of human PRR11. Synthetic peptide located within the following region: PGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKF

Rabbit Polyclonal Anti-PRR11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRR11 antibody is: synthetic peptide directed towards the C-terminal region of Human PRR11. Synthetic peptide located within the following region: TPLTNKENMETGTGLTPVMTQALRRKFQLAHPRSPTPTLPLSTSSFDEQN

Carrier-free (BSA/glycerol-free) PRR11 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PRR11 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PRR11 mouse monoclonal antibody, clone OTI5A8 (formerly 5A8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PRR11 mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PRR11 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI5A8 (formerly 5A8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI5A8 (formerly 5A8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PRR11 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated