Antibodies

Jump to Filters
View as table Download
PRSS21 Rabbit Polyclonal Antibody
TA335395

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRSS21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRSS21 Antibody: synthetic peptide directed towards the N terminal of human PRSS21. Synthetic peptide located within the following region: RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF
PRSS21 Rabbit Polyclonal Antibody
TA380427

USD 220.00

3 Weeks

PRSS21 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-220 of human PRSS21 (NP_006790.1).
Modifications Unmodified