Rabbit Polyclonal Anti-PRSS35 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRSS35 antibody: synthetic peptide directed towards the N terminal of human PRSS35. Synthetic peptide located within the following region: PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG |
Rabbit Polyclonal Anti-Prss35 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Prss35 antibody is: synthetic peptide directed towards the middle region of Mouse Prss35. Synthetic peptide located within the following region: HDGKDYVKGSKKLRVGVLKMRNKGGRKKRRGSKRSRREAESAGQSQAHLR |
Germany
Japan
United Kingdom
China