Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal PSENEN/PEN2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human PEN2 (within residues 50-101). [UniProt# Q9NZ42] |
Rabbit Polyclonal Anti-PSENEN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSENEN antibody: synthetic peptide directed towards the C terminal of human PSENEN. Synthetic peptide located within the following region: SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT |
Psenen Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
PEN2/PSENEN Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human PEN2/PEN2/PSENEN (NP_758844.1). |
| Modifications | Unmodified |
PEN2/PSENEN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human PEN2/PEN2/PSENEN (NP_758844.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PSENEN