Rabbit Polyclonal anti-PSG3 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSG3 antibody: synthetic peptide directed towards the N terminal of human PSG3. Synthetic peptide located within the following region: VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS |
PSG3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 29~58 amino acids from the N-terminal region of human PSG3 |
PSG3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSG3 |
Germany
Japan
United Kingdom
China
