Antibodies

Jump to Filters
View as table Download
PSG9 Rabbit Polyclonal Antibody
TA346332

USD 475.00

5 Days

Rabbit Polyclonal Anti-PSG9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSG9 antibody: synthetic peptide directed towards the N terminal of human PSG9. Synthetic peptide located within the following region: YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI
PSG9 (Center) Rabbit Polyclonal Antibody
AP53483PU-N

USD 450.00

2 Weeks

PSG9 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Central region of human PSG9