Rabbit Polyclonal Anti-PSIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSIP1 antibody: synthetic peptide directed towards the N terminal of human PSIP1. Synthetic peptide located within the following region: DNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVT |
Rabbit Polyclonal Anti-PSIP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSIP1 antibody: synthetic peptide directed towards the middle region of human PSIP1. Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK |
Rabbit Polyclonal Anti-PSIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSIP1 antibody: synthetic peptide directed towards the middle region of human PSIP1. Synthetic peptide located within the following region: LEKEQTGSKTLNGGSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEER |
Rabbit Polyclonal Anti-PSIP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSIP1 antibody: synthetic peptide directed towards the middle region of human PSIP1. Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK |
PSIP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 301-530 of human PSIP1 (NP_150091.2). |
| Modifications | Unmodified |
PSIP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 301-530 of human PSIP1 (NP_150091.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
