Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-PSMA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA5 antibody: synthetic peptide directed towards the N terminal of human PSMA5. Synthetic peptide located within the following region: MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV |
Rabbit polyclonal Anti-PSMA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA5 antibody: synthetic peptide directed towards the middle region of human PSMA5. Synthetic peptide located within the following region: FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK |
USD 1,140.00
2 Weeks
Mouse monoclonal Anti-PSMA5 Clone AH1.1
| Reactivities | Frog, Human |
| Conjugation | Unconjugated |
PSMA5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-241 of human PSMA5 (NP_002781.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PSMA5