Antibodies

Jump to Filters
View as table Download
Proteasome beta 1 (PSMB1) Rabbit Polyclonal Antibody
TA332393

USD 275.00

3 Weeks

Rabbit anti-PSMB1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMB1
Proteasome beta 1 (PSMB1) Rabbit Polyclonal Antibody
TA342163

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB1 antibody: synthetic peptide directed towards the middle region of human PSMB1. Synthetic peptide located within the following region: NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG