Antibodies

View as table Download

Rabbit polyclonal Anti-PSMD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD1 antibody: synthetic peptide directed towards the N terminal of human PSMD1. Synthetic peptide located within the following region: HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE

Rabbit polyclonal Anti-PSMD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD1 antibody: synthetic peptide directed towards the N terminal of human PSMD1. Synthetic peptide located within the following region: DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE

PSMD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 794-953 of human PSMD1 (NP_002798.2).
Modifications Unmodified