Goat Anti-DSCR2 / PSMG1 Antibody
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KLMTTNEIQSNIYT, from the C Terminus of the protein sequence according to NP_003711.1; NP_982257.1. |
Goat Anti-DSCR2 / PSMG1 Antibody
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KLMTTNEIQSNIYT, from the C Terminus of the protein sequence according to NP_003711.1; NP_982257.1. |
Rabbit Polyclonal Anti-PSMG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMG1 antibody: synthetic peptide directed towards the middle region of human PSMG1. Synthetic peptide located within the following region: VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT |
Rabbit Polyclonal Anti-PSMG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMG1 antibody: synthetic peptide directed towards the middle region of human PSMG1. Synthetic peptide located within the following region: TILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHD |
PSMG1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-288 of human PSMG1 (NP_003711.1). |
Modifications | Unmodified |