Rabbit Polyclonal Anti-PSTPIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSTPIP1 antibody is: synthetic peptide directed towards the N-terminal region of Human PSTPIP1. Synthetic peptide located within the following region: LLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSLKQQMENVGSSH |
PSTPIP1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 88-118 amino acids from the N-terminal region of Human PSTPIP1 / CD28P1 |
PSTPIP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PSTPIP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSTPIP1 |
PSTPIP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSTPIP1 |
PSTPIP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PSTPIP1 |
PSTPIP1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 157-416 of human PSTPIP1 (NP_003969.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
