Rabbit Polyclonal Anti-PTBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP2 antibody: synthetic peptide directed towards the N terminal of human PTBP2. Synthetic peptide located within the following region: MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE |
Rabbit Polyclonal Anti-PTBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP2 antibody: synthetic peptide directed towards the N terminal of human PTBP2. Synthetic peptide located within the following region: AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAV |
PTBP2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PTBP2 |
PTBP2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PTBP2 (NP_001287918.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
