Germany
Japan
United Kingdom
China
PTCH1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1) |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Patched Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Patched Antibody: A synthesized peptide derived from human Patched |
PTCH1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PTCH1 |
Rabbit Polyclonal Anti-PTCH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTCH1 antibody: synthetic peptide directed towards the C terminal of human PTCH1. Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM |
Rabbit Polyclonal Patched 1 Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to residues 269-279 of the human and mouse PTCH protein. |
Carrier-free (BSA/glycerol-free) PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTCH1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1214-1312 of human PTCH1 (NP_000255.2). |
| Modifications | Unmodified |
PTCH1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 770-970 of human PTCH1 (NP_000255.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PTCH1