Germany
Japan
United Kingdom
China
Rabbit polyclonal antibody to PTGES2 (prostaglandin E synthase 2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 106 and 343 of PTGES2 (Uniprot ID#Q9H7Z7) |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Ptges2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ptges2 antibody is: synthetic peptide directed towards the middle region of Mouse Ptges2. Synthetic peptide located within the following region: GAAAMYLISKRLKSRHHLQDDVRVDLYEAANKWVTAVGKDRPFMGGQKPN |
Rabbit Polyclonal Anti-Ptges2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ptges2 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Ptges2. Synthetic peptide located within the following region: RLLGAAALALGGALGLYHTVRWHQRSQDLRAERSAAQLPLSNSLQLTLYQ |
Rabbit Polyclonal Anti-PTGES2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the N-terminal region of Human PTGES2. Synthetic peptide located within the following region: KEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPN |
Rabbit Polyclonal Anti-PTGES2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the middle region of Human PTGES2. Synthetic peptide located within the following region: VAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMG |
Anti-PTGES2 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2 |
PTGES2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 88-377 of human PTGES2 (NP_079348.1). |
| Modifications | Unmodified |
PTGES2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 88-377 of human PTGES2 (NP_079348.1). |
| Modifications | Unmodified |
USD 420.00
5 Days
Active filters
Target Symbol
- PTGES2