Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PTGR1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PTGR1. |
Antibodies
View as table Download
PTGR1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PTGR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGR1 antibody: synthetic peptide directed towards the N terminal of human PTGR1. Synthetic peptide located within the following region: VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR |
PTGR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PTGR1 (NP_036344.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PTGR1