Antibodies

Jump to Filters
View as table Download
ZADH1 (PTGR2) Rabbit Polyclonal Antibody
TA316144

USD 345.00

In Stock

Rabbit polyclonal anti-PTGR2 (ZADH1) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZADH1.
ZADH1 (PTGR2) (N-term) Rabbit Polyclonal Antibody
AP53499PU-N

USD 450.00

2 Weeks

ZADH1 (PTGR2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 72-102 amino acids from the N-terminal region of Human ZADH1.
ZADH1 (PTGR2) Rabbit Polyclonal Antibody
TA338852

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTGR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZADH1 antibody: synthetic peptide directed towards the middle region of human ZADH1. Synthetic peptide located within the following region: ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT