Antibodies

Jump to Filters
View as table Download
PTPN20B (PTPN20) Rabbit Polyclonal Antibody
TA335960

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTPN20A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PTPN20A Antibody is: synthetic peptide directed towards the middle region of Human PTPN20A. Synthetic peptide located within the following region: LEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTR