Rabbit Polyclonal Bit1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Bit1 antibody was raised against a 16 amino acid peptide from near the center of human Bit1. |
Rabbit Polyclonal Bit1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Bit1 antibody was raised against a 16 amino acid peptide from near the center of human Bit1. |
Rabbit Polyclonal Bit1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Bit1 antibody was raised against a 15 amino acid peptide from near the amino-terminus of human Bit1. |
Rabbit Polyclonal Anti-PTRH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PTRH2 Antibody: synthetic peptide directed towards the C terminal of human PTRH2. Synthetic peptide located within the following region: RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT |
Rabbit Polyclonal Anti-PTRH2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PTRH2 |
PTRH2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PTRH2 |
PTRH2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-179 of human PTRH2 (NP_057161.1). |
Modifications | Unmodified |