Antibodies

View as table Download

PUM3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PUM3

Rabbit Polyclonal Anti-KIAA0020 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the N terminal of human KIAA0020. Synthetic peptide located within the following region: EVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVTSR

PUM3 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PUM3