Antibodies

View as table Download

Rabbit polyclonal PURB Antibody (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PURB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 260-289 amino acids from the C-terminal region of human PURB.

Rabbit Polyclonal Anti-PURB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PURB antibody: synthetic peptide directed towards the N terminal of human PURB. Synthetic peptide located within the following region: MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV

PURB Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse PURB

PURB Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human PURB.